PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Dca62279.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Caryophyllaceae; Caryophylleae; Dianthus
Family NAC
Protein Properties Length: 331aa    MW: 37760.6 Da    PI: 6.7931
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Dca62279.1genomeDCAView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM161.63e-50401683128
         NAM   3 pGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk.kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk...kg 97 
                 pGfrFhPtdeelv++yLk+kv++k+l++ e+ik++diyk++PwdL k   + ++kewyf++kr +ky+++ r+nr+t sg+Wkatg d++++s+   ++
  Dca62279.1  40 PGFRFHPTDEELVSFYLKRKVDKKPLSI-EIIKHMDIYKHDPWDLAKvGNSVGDKEWYFYCKRGRKYRNSVRPNRVTGSGFWKATGIDRPIYSNggeGH 137
                 9***************************.89**************8424445899**************************************966555 PP

         NAM  98 elvglkktLvfykgrapkgektdWvmheyrl 128
                 + vglkk+Lv+y+g+a kg+ktdW+mhe+rl
  Dca62279.1 138 RCVGLKKSLVYYRGSAGKGTKTDWMMHEFRL 168
                 66***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.24E-5235175IPR003441NAC domain
PROSITE profilePS5100548.96238190IPR003441NAC domain
PfamPF023659.3E-2540168IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 331 aa     Download sequence    Send to blast
MDVRSTMSCV SSQDNKDSGG GCGNKDVVVE VVDDHEGPLP GFRFHPTDEE LVSFYLKRKV  60
DKKPLSIEII KHMDIYKHDP WDLAKVGNSV GDKEWYFYCK RGRKYRNSVR PNRVTGSGFW  120
KATGIDRPIY SNGGEGHRCV GLKKSLVYYR GSAGKGTKTD WMMHEFRLPT TEVQNHGINS  180
SISTTNTFEA VRNLDAMXDW RELSTRRNAS NPNSKTSSFD SNHNNERYIS FTTRPTVLPN  240
NGFYTAVSPD IRERLSPYDN NDMTMDQKNV HFQDNHHQPQ SNSVVNLTPT TSNSTMLNVE  300
EDYENDFQCF EGHSWEDLTS VVEFAIKTPL L
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A2e-434016817140Stress-induced transcription factor NAC1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010693169.11e-116PREDICTED: transcription factor JUNGBRUNNEN 1-like
SwissprotQ9SK554e-75NAC42_ARATH; Transcription factor JUNGBRUNNEN 1
TrEMBLA0A0J8BD731e-116A0A0J8BD73_BETVU; Uncharacterized protein
STRINGGLYMA15G40950.14e-86(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G43000.14e-76NAC domain containing protein 42